Lineage for d4hsvc_ (4hsv C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929328Domain d4hsvc_: 4hsv C: [196784]
    automated match to d1f9qd_

Details for d4hsvc_

PDB Entry: 4hsv (more details), 2.08 Å

PDB Description: Crystal Structure of CXCL4L1
PDB Compounds: (C:) Platelet factor 4 variant

SCOPe Domain Sequences for d4hsvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hsvc_ d.9.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiikeh

SCOPe Domain Coordinates for d4hsvc_:

Click to download the PDB-style file with coordinates for d4hsvc_.
(The format of our PDB-style files is described here.)

Timeline for d4hsvc_: