![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
![]() | Protein automated matches [191267] (8 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [228444] (2 PDB entries) |
![]() | Domain d4hlla_: 4hll A: [228445] automated match to d4hb5a_ |
PDB Entry: 4hll (more details), 2.2 Å
SCOPe Domain Sequences for d4hlla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlla_ d.211.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} dlgkklleaaragqddevrlllehgadvnardsigstplhlaayyghleivrlllehgad vnardstgttplhyaarlghleivrlllehgadvnardamgwtplhlaakkghleivrll lkhgadvnandhfgktafdisidngnedlaeilq
Timeline for d4hlla_: