Lineage for d4hlla_ (4hll A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612557Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 2612558Protein automated matches [191267] (8 species)
    not a true protein
  7. 2612574Species Escherichia coli [TaxId:562] [228444] (2 PDB entries)
  8. 2612575Domain d4hlla_: 4hll A: [228445]
    automated match to d4hb5a_

Details for d4hlla_

PDB Entry: 4hll (more details), 2.2 Å

PDB Description: Crystal structure of Artificial ankyrin repeat protein_Ank(GAG)1D4
PDB Compounds: (A:) Ankyrin(GAG)1D4

SCOPe Domain Sequences for d4hlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlla_ d.211.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
dlgkklleaaragqddevrlllehgadvnardsigstplhlaayyghleivrlllehgad
vnardstgttplhyaarlghleivrlllehgadvnardamgwtplhlaakkghleivrll
lkhgadvnandhfgktafdisidngnedlaeilq

SCOPe Domain Coordinates for d4hlla_:

Click to download the PDB-style file with coordinates for d4hlla_.
(The format of our PDB-style files is described here.)

Timeline for d4hlla_: