Lineage for d4hcha1 (4hch A:-1-126)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413001Species Agrobacterium tumefaciens [TaxId:176299] [226505] (4 PDB entries)
  8. 1413002Domain d4hcha1: 4hch A:-1-126 [222498]
    Other proteins in same PDB: d4hcha2, d4hchb2
    automated match to d1rvka2
    complexed with edo, gol, mg, na, pge, tla

Details for d4hcha1

PDB Entry: 4hch (more details), 1.7 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate
PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcha1 d.54.1.0 (A:-1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
pvykligg

SCOPe Domain Coordinates for d4hcha1:

Click to download the PDB-style file with coordinates for d4hcha1.
(The format of our PDB-style files is described here.)

Timeline for d4hcha1:

1413002
d4hcha1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4hcha2