SCOPe 2.08: Domain d4hcha1: 4hch A:1-126

Lineage for d4hcha1 (4hch A:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)

8. Domain d4hcha1: 4hch A:1-126 [222498]
   Other proteins in same PDB: d4hcha2, d4hcha3, d4hchb2, d4hchb3
   automated match to d1rvka2
   complexed with edo, gol, mg, na, pge, tla

Details for d4hcha1

PDB Entry: 4hch, 1.7 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-tartrate

PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcha1:

Sequence; same for both SEQRES and ATOM records:

>d4hcha1 d.54.1.0 (A:1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

Timeline for d4hcha1:

• d4hcha1 first appeared in SCOPe 2.03
  
• d4hcha1 appears in SCOPe 2.07