Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) automatically mapped to Pfam PF01255 |
Protein automated matches [190121] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [194209] (2 PDB entries) |
Domain d4h8ea_: 4h8e A: [194210] automated match to d1f75a_ complexed with fpp, mg, so4 |
PDB Entry: 4h8e (more details), 1.3 Å
SCOPe Domain Sequences for d4h8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h8ea_ c.101.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]} ldssnipehiaiimdgngrwakkrkmprikghyegmqtikkitriasdigvkyltlyafs tenwsrpesevnyimnlpvnflktflpelieknvkvetigftdklpkstieainnakekt anntglklifainyggraelvhsiknmfdelhqqglnsdiidetyinnhlmtkdypdpel lirtsgeqrisnfliwqvsysefifnqklwpdfdedelikcikiyqsrqrrfggl
Timeline for d4h8ea_: