Lineage for d1f75a_ (1f75 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) 
the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinaseFamily c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
automatically mapped to Pfam PF01255
Protein Undecaprenyl diphosphate synthase [64007] (3 species) 
Species Micrococcus luteus [TaxId:1270] [64008] (1 PDB entry) 
Domain d1f75a_: 1f75 A: [59662]
complexed with so4
Details for d1f75a_
PDB Entry: 1f75 (more details), 2.2 Å
PDB Description: crystal structure of undecaprenyl diphosphate synthase from micrococcus luteus b-p 26
PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetaseSCOPe Domain Sequences for d1f75a_:
Sequence, based on SEQRES records: (download)
>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
stenwsrpkdevnylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakek
tkhntgltlvfalnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpe
llirtsgeerlsnfliwqcsysefvfidefwpdfneeslaqcisiyqnr
Sequence, based on observed residues (ATOM records): (download)
>d1f75a_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Micrococcus luteus [TaxId: 1270]}
ninaaqipkhiaiimdgngrwakqkkmprikghyegmqtvrkitryasdlgvkyltlyaf
nylmklpgdflntflpelieknvkvetigfiddlpdhtkkavleakektkhntgltlvfa
lnyggrkeiisavqliaeryksgeisldeisethfneylftanmpdpellirtsgeerls
nfliwqcsysefvfidefwpdfneeslaqcisiyqnr
SCOPe Domain Coordinates for d1f75a_:
Click to download the PDB-style file with coordinates for d1f75a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f75a_:
- d1f75a_ first appeared in SCOP 1.57
- d1f75a_ appears in SCOPe 2.07
View in 3D
