Lineage for d4h4aa_ (4h4a A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670568Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 1670569Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 1670706Family d.136.1.0: automated matches [194358] (1 protein)
    not a true family
  6. 1670707Protein automated matches [194381] (1 species)
    not a true protein
  7. 1670708Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [194383] (2 PDB entries)
  8. 1670709Domain d4h4aa_: 4h4a A: [194386]
    automated match to d1byra_

Details for d4h4aa_

PDB Entry: 4h4a (more details), 2.2 Å

PDB Description: crystal structure of the c-terminal domain of drosophila melanogaster zucchini
PDB Compounds: (A:) Mitochondrial cardiolipin hydrolase

SCOPe Domain Sequences for d4h4aa_:

Sequence, based on SEQRES records: (download)

>d4h4aa_ d.136.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpmgslrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvys
kgsqismlaqlgvpvrvpittnlmhnkfciidgferveeirllrklkfmrpcysivisgs
vnwtalglggnwenciitaddkltatfqaefqrmwrafaktegsqiqlk

Sequence, based on observed residues (ATOM records): (download)

>d4h4aa_ d.136.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpmgslrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvys
kgsqismlaqlgvpvrvpitlmhnkfciidgferveeirllrkrpcysivisgsvnwtgn
wenciitaddkltatfqaefqrmwraqiqlk

SCOPe Domain Coordinates for d4h4aa_:

Click to download the PDB-style file with coordinates for d4h4aa_.
(The format of our PDB-style files is described here.)

Timeline for d4h4aa_: