Lineage for d4h12a_ (4h12 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028745Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 3028746Superfamily f.54.1: SNF-like [161070] (3 families) (S)
  5. 3028818Family f.54.1.2: Amino acid antiporter-like [418818] (5 proteins)
    Pfam PF00324 and Pfam PF13520
  6. 3028835Protein Protein lysine methyltransferase (PKMT) SET domain-containing protein 2 (SETD2) [419136] (1 species)
  7. 3028836Species Human (Homo sapiens) [TaxId:9606] [419658] (10 PDB entries)
  8. 3028842Domain d4h12a_: 4h12 A: [413809]
    protein/DNA complex; complexed with cl, sah, zn

Details for d4h12a_

PDB Entry: 4h12 (more details), 2.06 Å

PDB Description: The crystal structure of methyltransferase domain of human SET domain-containing protein 2 in complex with S-adenosyl-L-homocysteine
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD2

SCOPe Domain Sequences for d4h12a_:

Sequence, based on SEQRES records: (download)

>d4h12a_ f.54.1.2 (A:) Protein lysine methyltransferase (PKMT) SET domain-containing protein 2 (SETD2) {Human (Homo sapiens) [TaxId: 9606]}
pscvmddfrdpqrwkecakqgkmpcyfdlieenvylterkknkshrdikrmqcectplsk
deraqgeiacgedclnrllmiecssrcpngdycsnrrfqrkqhadveviltekkgwglra
akdlpsntfvleycgevldhkefkarvkeyarnknihyyfmalkndeiidatqkgncsrf
mnhscepncetqkwtvngqlrvgffttklvpsgseltfdyqfqrygkeaqkcfcgsancr
gylgg

Sequence, based on observed residues (ATOM records): (download)

>d4h12a_ f.54.1.2 (A:) Protein lysine methyltransferase (PKMT) SET domain-containing protein 2 (SETD2) {Human (Homo sapiens) [TaxId: 9606]}
pscvmddfrdpqrwkecakqgkmpcyfdlieenvyltemqcectplskderaqgeiacge
dclnrllmiecssrcpngdycsnrrfqrkqhadveviltekkgwglraakdlpsntfvle
ycgevldhkefkarvkeyarnknihyyfmalkndeiidatqkgncsrfmnhscepncetq
kwtvngqlrvgffttklvpsgseltfdyqfqrygkeaqkcfcgsancrgylgg

SCOPe Domain Coordinates for d4h12a_:

Click to download the PDB-style file with coordinates for d4h12a_.
(The format of our PDB-style files is described here.)

Timeline for d4h12a_:

  • d4h12a_ is new in SCOPe 2.08-stable