Lineage for d4gw1c1 (4gw1 C:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1297211Species Murinae,homo sapiens [TaxId:39107] [228174] (2 PDB entries)
  8. 1297215Domain d4gw1c1: 4gw1 C:1-107 [229500]
    Other proteins in same PDB: d4gw1a2, d4gw1c2
    automated match to d1g9ml1
    complexed with po4

Details for d4gw1c1

PDB Entry: 4gw1 (more details), 2.24 Å

PDB Description: cqfd meditope
PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4gw1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gw1c1 b.1.1.0 (C:1-107) automated matches {Murinae,homo sapiens [TaxId: 39107]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

SCOPe Domain Coordinates for d4gw1c1:

Click to download the PDB-style file with coordinates for d4gw1c1.
(The format of our PDB-style files is described here.)

Timeline for d4gw1c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gw1c2