| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Murinae, homo sapiens [TaxId:39107] [228174] (2 PDB entries) |
| Domain d4gw1c1: 4gw1 C:1-107 [229500] Other proteins in same PDB: d4gw1a2, d4gw1c2 automated match to d1g9ml1 complexed with po4 |
PDB Entry: 4gw1 (more details), 2.24 Å
SCOPe Domain Sequences for d4gw1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gw1c1 b.1.1.0 (C:1-107) automated matches {Murinae, homo sapiens [TaxId: 39107]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk
Timeline for d4gw1c1:
View in 3DDomains from other chains: (mouse over for more information) d4gw1a1, d4gw1a2, d4gw1b_, d4gw1d_ |