Lineage for d4gtla_ (4gtl A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) 
automatically mapped to Pfam PF02511Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) Protein Thy1 homologue [69798] (1 species) Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
TM0449
Domain d4gtla_: 4gtl A: [194504]
automated match to d1o2ab_
complexed with fad; mutant
Details for d4gtla_
PDB Entry: 4gtl (more details), 2.17 Å
PDB Description: t. maritima fdts (r174k mutant) with fad
PDB Compounds: (A:) Thymidylate synthase thyXSCOPe Domain Sequences for d4gtla_:
Sequence, based on SEQRES records: (download)
>d4gtla_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpf
ehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipper
vtekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkads
haqweiqqyalaiarifkekcpwtfeaflkyaykgdilke
Sequence, based on observed residues (ATOM records): (download)
>d4gtla_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hhhmkidildkgfvelvdvmgndlsavraarvsfdmdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsrysklsyefyipsperlegykttippervtek
iseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlkadshaqw
eiqqyalaiarifkekcpwtfeaflkyaykgdilke
SCOPe Domain Coordinates for d4gtla_:
Click to download the PDB-style file with coordinates for d4gtla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gtla_:
- d4gtla_ first appeared in SCOPe 2.02
- d4gtla_ appears in SCOPe 2.04
- d4gtla_ is called d4gtla1 in SCOPe 2.06
- d4gtla_ appears in the current release, SCOPe 2.08, called d4gtla1
View in 3D
