| Class b: All beta proteins [48724] (177 folds) |
| Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
| Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
| Protein automated matches [254706] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255964] (18 PDB entries) |
| Domain d4fyqa1: 4fyq A:68-287 [266275] Other proteins in same PDB: d4fyqa2, d4fyqa3, d4fyqa4 automated match to d4p8qa1 complexed with acy, nag, so4, zn |
PDB Entry: 4fyq (more details), 1.9 Å
SCOPe Domain Sequences for d4fyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fyqa1 b.98.1.0 (A:68-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihskkl
nytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefegela
ddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdltals
nmlpkgpstplpedpnwnvtefhttpkmstyllafivsef
Timeline for d4fyqa1: