Lineage for d4fl4g_ (4fl4 G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751406Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 1751407Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 1751425Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 1751426Protein automated matches [190928] (5 species)
    not a true protein
  7. 1751438Species Clostridium thermocellum [TaxId:1515] [256259] (1 PDB entry)
  8. 1751441Domain d4fl4g_: 4fl4 G: [240139]
    Other proteins in same PDB: d4fl4b_, d4fl4e_, d4fl4h_, d4fl4k_
    automated match to d1dava_
    complexed with ca, so4

Details for d4fl4g_

PDB Entry: 4fl4 (more details), 2.8 Å

PDB Description: Scaffoldin conformation and dynamics revealed by a ternary complex from the Clostridium thermocellum cellulosome
PDB Compounds: (G:) Glycoside hydrolase family 9

SCOPe Domain Sequences for d4fl4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl4g_ a.139.1.0 (G:) automated matches {Clostridium thermocellum [TaxId: 1515]}
hmgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsryli
rvieklp

SCOPe Domain Coordinates for d4fl4g_:

Click to download the PDB-style file with coordinates for d4fl4g_.
(The format of our PDB-style files is described here.)

Timeline for d4fl4g_: