Class a: All alpha proteins [46456] (286 folds) |
Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
Superfamily a.139.1: Type I dockerin domain [63446] (2 families) |
Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
Protein automated matches [190928] (5 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [256259] (1 PDB entry) |
Domain d4fl4g_: 4fl4 G: [240139] Other proteins in same PDB: d4fl4b_, d4fl4e_, d4fl4h_, d4fl4k_ automated match to d1dava_ complexed with ca, so4 |
PDB Entry: 4fl4 (more details), 2.8 Å
SCOPe Domain Sequences for d4fl4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fl4g_ a.139.1.0 (G:) automated matches {Clostridium thermocellum [TaxId: 1515]} hmgdvnddgkvnstdltllkryvlkavstlpsskaeknadvnrdgrvnssdvtilsryli rvieklp
Timeline for d4fl4g_: