Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (17 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311378] (11 PDB entries) |
Domain d4fkha2: 4fkh A:283-544 [307368] Other proteins in same PDB: d4fkha1, d4fkha3, d4fkha4, d4fkha5 automated match to d4fyta2 complexed with ala, nag, zn |
PDB Entry: 4fkh (more details), 2.05 Å
SCOPe Domain Sequences for d4fkha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkha2 d.92.1.0 (A:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda qtsirlpdtvraimdrwtlqmg
Timeline for d4fkha2:
View in 3D Domains from same chain: (mouse over for more information) d4fkha1, d4fkha3, d4fkha4, d4fkha5 |