Lineage for d4ek1b_ (4ek1 B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
Uniprot P00183
Domain d4ek1b_: 4ek1 B: [194903]
automated match to d1t87a_
complexed with cam, hem, k, mtn
Details for d4ek1b_
PDB Entry: 4ek1 (more details), 1.97 Å
PDB Description: Crystal Structure of Electron-Spin Labeled Cytochrome P450cam
PDB Compounds: (B:) Camphor 5-monooxygenaseSCOPe Domain Sequences for d4ek1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ek1b_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqecnvpdlvwtrsngghwiatrgq
lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
cmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka
SCOPe Domain Coordinates for d4ek1b_:
Click to download the PDB-style file with coordinates for d4ek1b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ek1b_:
- d4ek1b_ first appeared in SCOPe 2.02
- d4ek1b_ appears in SCOPe 2.03
- d4ek1b_ appears in SCOPe 2.05
- d4ek1b_ appears in the current release, SCOPe 2.08
View in 3D
