Lineage for d4edob_ (4edo B:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) Protein automated matches [190406] (14 species)
not a true protein
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (21 PDB entries) 
Domain d4edob_: 4edo B: [193746]
automated match to d3pj7c_
Details for d4edob_
PDB Entry: 4edo (more details), 1.8 Å
PDB Description: Crystal structure of far-red fluorescent protein eqFP650
PDB Compounds: (B:) far-red fluorescent protein eqFP650SCOPe Domain Sequences for d4edob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4edob_ d.22.1.1 (B:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elisenmhmklymegtvnghhfkctsegegkpyegtqtakikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwerittyedggvltatqdtslqngcliynvkin
gvnfpsngpvmqkktlgweastemlypadsglrghsqmalklvgggylhcslkttyrskk
paknlkmpgfyfvdrklerikeadketyveqhemavarycd
SCOPe Domain Coordinates for d4edob_:
Click to download the PDB-style file with coordinates for d4edob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4edob_:
- d4edob_ first appeared in SCOPe 2.02
- d4edob_ appears in SCOPe 2.03
- d4edob_ appears in SCOPe 2.05
- d4edob_ appears in the current release, SCOPe 2.08
View in 3D
