Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:388272] [226355] (2 PDB entries) |
Domain d4ecib2: 4eci B:82-202 [220417] Other proteins in same PDB: d4ecia1, d4ecib1 automated match to d1k0db1 complexed with act |
PDB Entry: 4eci (more details), 1.8 Å
SCOPe Domain Sequences for d4ecib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecib2 a.45.1.0 (B:82-202) automated matches {Pseudomonas aeruginosa [TaxId: 388272]} lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp r
Timeline for d4ecib2: