Lineage for d4e2da_ (4e2d A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437406Species Trypanosoma cruzi [TaxId:5693] [189890] (4 PDB entries)
  8. 2437414Domain d4e2da_: 4e2d A: [196701]
    automated match to d3atya_
    complexed with dms, fmn

Details for d4e2da_

PDB Entry: 4e2d (more details), 2 Å

PDB Description: Structure of the old yellow enzyme from Trypanosoma cruzi
PDB Compounds: (A:) Old Yellow Protein

SCOPe Domain Sequences for d4e2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e2da_ c.1.4.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
atfpellrplklgrytlrnriimapltrcqatedghvprtesmlkyyedrasagliiaea
tmvqpnytgfltepgiysdaqieewrkivdavhkkggliflqlihagragipekilqqpk
sdqdplagrllaasaipikdhripayfaasgeketygvpeeltddevrngiiplfvegak
naifkagfdgveihgangylldaffressnkrqsgpyagttidtrcqliydvtksvcdav
gsdrvglrisplngvhgmidsnpealtkhlckkieplslaylhylrgdmvnqqigdvvaw
vrgsysgvkisnlrydfeeadqqiregkvdavafgakfianpdlveraqhdwplneprpe
tyytrtavgyndyptyn

SCOPe Domain Coordinates for d4e2da_:

Click to download the PDB-style file with coordinates for d4e2da_.
(The format of our PDB-style files is described here.)

Timeline for d4e2da_: