| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (14 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
| Domain d4dgil2: 4dgi L:108-213 [234317] Other proteins in same PDB: d4dgia_, d4dgil1 automated match to d1l7tl2 complexed with na |
PDB Entry: 4dgi (more details), 2.4 Å
SCOPe Domain Sequences for d4dgil2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgil2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne
Timeline for d4dgil2: