Lineage for d4cbya_ (4cby A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874235Protein automated matches [190786] (1 species)
    not a true protein
  7. 2874236Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. 2874311Domain d4cbya_: 4cby A: [229566]
    Other proteins in same PDB: d4cbyd2
    automated match to d3c0ya1
    complexed with kee, na, zn

Details for d4cbya_

PDB Entry: 4cby (more details), 2.72 Å

PDB Description: design, synthesis, and biological evaluation of potent and selective class iia hdac inhibitors as a potential therapy for huntington's disease
PDB Compounds: (A:) Histone deacetylase 4

SCOPe Domain Sequences for d4cbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbya_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatleelq
tvhseahtllygtnpanrqkldskkllgslasvfvrlpcggvgvdsdtiwnevhsagaar
lavgcvvelvfkvatgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqrlsvs
kilivdwdvhhgngtqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgfnvnm
aftggldppmgdaeylaafrtvvmpiasefapdvvlvssgfdaveghptplggynlsarc
fgyltkqlmglaggrivlalegghdltaicdaseacvsallgneldplpekvlqqrpnan
avrsmekvmeihskywrclq

SCOPe Domain Coordinates for d4cbya_:

Click to download the PDB-style file with coordinates for d4cbya_.
(The format of our PDB-style files is described here.)

Timeline for d4cbya_: