Lineage for d4appa_ (4app A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1932861Domain d4appa_: 4app A: [195238]
    automated match to d2x4za_
    complexed with gol, n53

Details for d4appa_

PDB Entry: 4app (more details), 2.2 Å

PDB Description: crystal structure of the human p21-activated kinase 4 in complex with (s)-n-(5-(3-benzyl-1-methylpiperazine-4-carbonyl)-6,6-dimethyl-1,4,5, 6-tetrahydropyrrolo(3,4-c)pyrazol-3-yl)-3-phenoxybenzamide
PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d4appa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4appa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqq
rrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqia
avclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgt
pywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknl
hkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnrtr

SCOPe Domain Coordinates for d4appa_:

Click to download the PDB-style file with coordinates for d4appa_.
(The format of our PDB-style files is described here.)

Timeline for d4appa_: