Lineage for d4ac9a3 (4ac9 A:272-387)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403439Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2403453Protein Elongation factor SelB, domain 3 [117223] (1 species)
  7. 2403454Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
    Uniprot Q8J307
  8. 2403455Domain d4ac9a3: 4ac9 A:272-387 [192247]
    Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a4, d4ac9a5, d4ac9b1, d4ac9b2, d4ac9b4, d4ac9c1, d4ac9c2, d4ac9c4, d4ac9c5, d4ac9d1, d4ac9d2, d4ac9d4
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9a3

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (A:) mj0495-like protein

SCOPe Domain Sequences for d4ac9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac9a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

SCOPe Domain Coordinates for d4ac9a3:

Click to download the PDB-style file with coordinates for d4ac9a3.
(The format of our PDB-style files is described here.)

Timeline for d4ac9a3: