Lineage for d3zrsa1 (3zrs A:12-138)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629173Protein automated matches [190184] (3 species)
    not a true protein
  7. 2629176Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (5 PDB entries)
  8. 2629179Domain d3zrsa1: 3zrs A:12-138 [250822]
    Other proteins in same PDB: d3zrsa2, d3zrsa3
    automated match to d2wlka1
    complexed with cl, k

Details for d3zrsa1

PDB Entry: 3zrs (more details), 3.05 Å

PDB Description: X-ray crystal structure of a KirBac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate.
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d3zrsa1:

Sequence, based on SEQRES records: (download)

>d3zrsa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarli
yarftrp

Sequence, based on observed residues (ATOM records): (download)

>d3zrsa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien
arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarftr
p

SCOPe Domain Coordinates for d3zrsa1:

Click to download the PDB-style file with coordinates for d3zrsa1.
(The format of our PDB-style files is described here.)

Timeline for d3zrsa1: