Lineage for d3w1ya_ (3w1y A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178996Species Trypanosoma brucei [TaxId:999953] [229344] (2 PDB entries)
  8. 2178997Domain d3w1ya_: 3w1y A: [229345]
    automated match to d3vvwb_

Details for d3w1ya_

PDB Entry: 3w1y (more details), 2.3 Å

PDB Description: Crystal structure of T brucei ATG8.2 in complex with E coli S10
PDB Compounds: (A:) Microtubule-associated protein 1A/1B, light chain 3

SCOPe Domain Sequences for d3w1ya_:

Sequence, based on SEQRES records: (download)

>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
hyryqytrsfaeraketesarlrypkhipilceptsaasastprdvrlfstrqqvqreld
cnkfllpetatvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgfl
yvsygvent

Sequence, based on observed residues (ATOM records): (download)

>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
hyryqytrsfaeraketesarlrypkhipilceptsvrlfstrqqvqreldcnkfllpet
atvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgflyvsygvent

SCOPe Domain Coordinates for d3w1ya_:

Click to download the PDB-style file with coordinates for d3w1ya_.
(The format of our PDB-style files is described here.)

Timeline for d3w1ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3w1yb_