Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [229344] (2 PDB entries) |
Domain d3w1ya_: 3w1y A: [229345] automated match to d3vvwb_ |
PDB Entry: 3w1y (more details), 2.3 Å
SCOPe Domain Sequences for d3w1ya_:
Sequence, based on SEQRES records: (download)
>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} hyryqytrsfaeraketesarlrypkhipilceptsaasastprdvrlfstrqqvqreld cnkfllpetatvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgfl yvsygvent
>d3w1ya_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]} hyryqytrsfaeraketesarlrypkhipilceptsvrlfstrqqvqreldcnkfllpet atvmefmmalrqrllleegqavfvfignelppnsaclgdiyarakdpdgflyvsygvent
Timeline for d3w1ya_: