Lineage for d3vila_ (3vil A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1570862Species Neotermes koshunensis [TaxId:60586] [189411] (13 PDB entries)
  8. 1570872Domain d3vila_: 3vil A: [194992]
    automated match to d3ahza_
    complexed with cl, edo, na, sa0, sa9

Details for d3vila_

PDB Entry: 3vil (more details), 1.15 Å

PDB Description: crystal structure of beta-glucosidase from termite neotermes koshunensis in complex with salicin
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3vila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vila_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]}
tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnspltfmdgyaseig
mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd

SCOPe Domain Coordinates for d3vila_:

Click to download the PDB-style file with coordinates for d3vila_.
(The format of our PDB-style files is described here.)

Timeline for d3vila_: