Lineage for d3uwub_ (3uwu B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121Protein Triosephosphate isomerase [51353] (20 species) 
Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries) 
Domain d3uwub_: 3uwu B: [217555]
automated match to d3uwva_
complexed with cit, g3p
Details for d3uwub_
PDB Entry: 3uwu (more details), 2.15 Å
PDB Description: Crystal structure of Staphylococcus Aureus triosephosphate isomerase complexed with glycerol-3-phosphate
PDB Compounds: (B:) triosephosphate isomeraseSCOPe Domain Sequences for d3uwub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uwub_ c.1.1.1 (B:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
mrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaqg
leigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaifk
hgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgkss
tsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggasl
kvedfvqllega
SCOPe Domain Coordinates for d3uwub_:
Click to download the PDB-style file with coordinates for d3uwub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3uwub_:
- d3uwub_ first appeared in SCOPe 2.03
- d3uwub_ appears in SCOPe 2.05
- d3uwub_ appears in SCOPe 2.07
- d3uwub_ appears in the current release, SCOPe 2.08
View in 3D
