Lineage for d3usya_ (3usy A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.14: FliG [48029] (2 families) 
fragmented superhelix; consist of 3/4-helical motifs and connecting helices
Family a.118.14.0: automated matches [191676] (1 protein)
not a true familyProtein automated matches [191304] (1 species)
not a true proteinSpecies Helicobacter pylori [TaxId:210] [190009] (2 PDB entries) 
Domain d3usya_: 3usy A: [186403]
automated match to d1lkvx_
Details for d3usya_
PDB Entry: 3usy (more details), 2.71 Å
PDB Description: Crystal structure of Flig (residue 116-343) from H. Pylori
PDB Compounds: (A:) flagellar motor switch proteinSCOPe Domain Sequences for d3usya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3usya_ a.118.14.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
gplgsmqknfaylgkikpqqladfiinehpqtialilahmeapnaaetlsyfpdemkaei
sirmanlgeispqvvkrvstvlenklesltsykievgglravaeifnrlgqksakttlar
iesvdnklagaikemmftfedivkldnfaireilkvadkkdlslalktstkdltdkflnn
mssraaeqfveemqylgavkikdvdvaqrkiieivqslqekgviqtg
SCOPe Domain Coordinates for d3usya_:
Click to download the PDB-style file with coordinates for d3usya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3usya_:
- d3usya_ first appeared in SCOPe 2.01
- d3usya_ appears in SCOPe 2.04
- d3usya_ is called d3usya1 in SCOPe 2.06
- d3usya_ appears in the current release, SCOPe 2.08, called d3usya1
View in 3D
