Lineage for d3ukug_ (3uku G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746510Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 1746511Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 1746517Protein automated matches [190348] (1 species)
    not a true protein
  7. 1746518Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 1746531Domain d3ukug_: 3uku G: [194000]
    Other proteins in same PDB: d3ukua1, d3ukua2, d3ukub_, d3ukuc_, d3ukud1, d3ukud2, d3ukue_, d3ukuf_
    automated match to d3dxkg_
    complexed with c69

Details for d3ukug_

PDB Entry: 3uku (more details), 2.75 Å

PDB Description: Structure of Arp2/3 complex with bound inhibitor CK-869
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3ukug_:

Sequence, based on SEQRES records: (download)

>d3ukug_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sarfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintk
sqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllq
whekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d3ukug_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sarfrkvdvgeydenkfvdeedagpdegevdsclrqgnmtaalqaalknppintksqavk
dragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdssavllqwhekal
aaggvgsivrvltarktv

SCOPe Domain Coordinates for d3ukug_:

Click to download the PDB-style file with coordinates for d3ukug_.
(The format of our PDB-style files is described here.)

Timeline for d3ukug_: