Lineage for d3ujmb_ (3ujm B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.0: automated matches [191337] (1 protein)
not a true familyProtein automated matches [190205] (21 species)
not a true protein
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [195496] (1 PDB entry) 
Domain d3ujmb_: 3ujm B: [195497]
automated match to d3q90b_
complexed with epe
Details for d3ujmb_
PDB Entry: 3ujm (more details), 2.74 Å
PDB Description: crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein
PDB Compounds: (B:) RasputinSCOPe Domain Sequences for d3ujmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ujmb_ d.17.4.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
msvgrefvrqyytllnkapnhlhrfynhnssyihgesklvvgqreihnriqqlnfndcha
kisqvdaqatlgngvvvqvtgelsndgqpmrrftqtfvlaaqspkkyyvhndifryq
SCOPe Domain Coordinates for d3ujmb_:
Click to download the PDB-style file with coordinates for d3ujmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ujmb_:
- d3ujmb_ first appeared in SCOPe 2.02
- d3ujmb_ appears in SCOPe 2.04
- d3ujmb_ is called d3ujmb1 in SCOPe 2.06
- d3ujmb_ appears in the current release, SCOPe 2.08, called d3ujmb1
View in 3D
