![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (33 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93061] [193276] (7 PDB entries) |
![]() | Domain d3ufab_: 3ufa B: [193277] automated match to d2as9a_ complexed with cl, vpf |
PDB Entry: 3ufa (more details), 1.8 Å
SCOPe Domain Sequences for d3ufab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ufab_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]} eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek nfgvyftpqlkefiqnniek
Timeline for d3ufab_: