Lineage for d3ufab_ (3ufa B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.0: automated matches [191364] (1 protein)
not a true familyProtein automated matches [190438] (33 species)
not a true protein
Species Staphylococcus aureus [TaxId:93061] [193276] (7 PDB entries) 
Domain d3ufab_: 3ufa B: [193277]
automated match to d2as9a_
complexed with cl, vpf
Details for d3ufab_
PDB Entry: 3ufa (more details), 1.8 Å
PDB Description: Crystal structure of the staphylococcal serine protease SplA in complex with a specific phosphonate inhibitor
PDB Compounds: (B:) serine protease splaSCOPe Domain Sequences for d3ufab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ufab_ b.47.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
nfgvyftpqlkefiqnniek
SCOPe Domain Coordinates for d3ufab_:
Click to download the PDB-style file with coordinates for d3ufab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ufab_:
- d3ufab_ first appeared in SCOPe 2.02
- d3ufab_ appears in SCOPe 2.06
- d3ufab_ appears in the current release, SCOPe 2.08
View in 3D
