Lineage for d3u74u3 (3u74 U:188-283)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637241Family g.7.1.0: automated matches [191613] (1 protein)
    not a true family
  6. 2637242Protein automated matches [191119] (7 species)
    not a true protein
  7. 2637250Species Human (Homo sapiens) [TaxId:9606] [256115] (2 PDB entries)
  8. 2637253Domain d3u74u3: 3u74 U:188-283 [250144]
    automated match to d2i9be1
    complexed with nag; mutant

Details for d3u74u3

PDB Entry: 3u74 (more details), 2.39 Å

PDB Description: crystal structure of stabilized human upar mutant
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3u74u3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u74u3 g.7.1.0 (U:188-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqngrqcysckgnsthgcsseetflidcrgpmnqclvatgthepknqsymvrgcatasmc
qhahlgdafsmchidvscctksgcnhpdldvqyrsg

SCOPe Domain Coordinates for d3u74u3:

Click to download the PDB-style file with coordinates for d3u74u3.
(The format of our PDB-style files is described here.)

Timeline for d3u74u3: