| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.0: automated matches [191593] (1 protein) not a true family |
| Protein automated matches [191080] (7 species) not a true protein |
| Species Mycobacterium marinum [TaxId:216594] [196128] (1 PDB entry) |
| Domain d3tzud_: 3tzu D: [196129] automated match to d3ifta_ complexed with act, edo, peg |
PDB Entry: 3tzu (more details), 2.3 Å
SCOPe Domain Sequences for d3tzud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tzud_ b.84.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ipgdrsytadhewidiapgaatpdgpvrvgitsvavealgdlvfvqlpevgetvsagesc
gevestktvsdliapasgqivevntaavddpatiatdpygagwlysvqptavgelltase
yagqngl
Timeline for d3tzud_: