Lineage for d3ttzb_ (3ttz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667973Species Staphylococcus aureus [TaxId:1280] [232247] (9 PDB entries)
  8. 1667977Domain d3ttzb_: 3ttz B: [239831]
    automated match to d3ttza_
    complexed with 07n, mg

Details for d3ttzb_

PDB Entry: 3ttz (more details), 1.63 Å

PDB Description: crystal structure of a topoisomerase atpase inhibitor
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d3ttzb_:

Sequence, based on SEQRES records: (download)

>d3ttzb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl
kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv
redsyhye

Sequence, based on observed residues (ATOM records): (download)

>d3ttzb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv
tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
syhye

SCOPe Domain Coordinates for d3ttzb_:

Click to download the PDB-style file with coordinates for d3ttzb_.
(The format of our PDB-style files is described here.)

Timeline for d3ttzb_: