Lineage for d3to5a_ (3to5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855772Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 2855773Domain d3to5a_: 3to5 A: [194702]
    automated match to d2chfa_
    complexed with ca

Details for d3to5a_

PDB Entry: 3to5 (more details), 1.65 Å

PDB Description: High resolution structure of CheY3 from Vibrio cholerae
PDB Compounds: (A:) CheY homolog

SCOPe Domain Sequences for d3to5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3to5a_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
lnknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
kife

SCOPe Domain Coordinates for d3to5a_:

Click to download the PDB-style file with coordinates for d3to5a_.
(The format of our PDB-style files is described here.)

Timeline for d3to5a_: