![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein automated matches [190177] (9 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries) |
![]() | Domain d3to5a_: 3to5 A: [194702] automated match to d2chfa_ complexed with ca |
PDB Entry: 3to5 (more details), 1.65 Å
SCOPe Domain Sequences for d3to5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3to5a_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]} lnknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld kife
Timeline for d3to5a_: