Lineage for d3tkka_ (3tkk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779511Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779556Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) (S)
    decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243
  5. 1779564Family b.23.3.0: automated matches [191463] (1 protein)
    not a true family
  6. 1779565Protein automated matches [190714] (2 species)
    not a true protein
  7. 1779571Species Thermoanaerobacter tengcongensis [TaxId:119072] [189810] (1 PDB entry)
  8. 1779572Domain d3tkka_: 3tkk A: [185867]
    automated match to d2f4la1
    complexed with ca, zn

Details for d3tkka_

PDB Entry: 3tkk (more details), 1.99 Å

PDB Description: Crystal Structure Analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis
PDB Compounds: (A:) Predicted acetamidase/formamidase

SCOPe Domain Sequences for d3tkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkka_ b.23.3.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
shmkyslsadhhifafskenkpaisvksgdelevetmdcfsnqiqsnedkldemdwnrvn
patgpifvegakegdvlkvkikkievaekgvlatgkglgvlgnlmeglyskvvdikdgkv
ifneklalpvkpmigvigvapkegsincgtpgshggnmdttliaegaevyfpvfvegall
algdlhalmgdgevgvsgvevagkvllevevikglnlknpvvktaevtatiasaesldka
veiavhdmaelfkkhtdlstegiatlfsitgnaqisqvvdplktarfslpnwilesygir
f

SCOPe Domain Coordinates for d3tkka_:

Click to download the PDB-style file with coordinates for d3tkka_.
(The format of our PDB-style files is described here.)

Timeline for d3tkka_: