![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) ![]() decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243 |
![]() | Family b.23.3.0: automated matches [191463] (1 protein) not a true family |
![]() | Protein automated matches [190714] (2 species) not a true protein |
![]() | Species Thermoanaerobacter tengcongensis [TaxId:119072] [189810] (2 PDB entries) |
![]() | Domain d3tkka1: 3tkk A:1-299 [185867] Other proteins in same PDB: d3tkka2, d3tkkb2, d3tkkc2, d3tkkd2 automated match to d2f4la1 complexed with ca, zn |
PDB Entry: 3tkk (more details), 1.99 Å
SCOPe Domain Sequences for d3tkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tkka1 b.23.3.0 (A:1-299) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]} mkyslsadhhifafskenkpaisvksgdelevetmdcfsnqiqsnedkldemdwnrvnpa tgpifvegakegdvlkvkikkievaekgvlatgkglgvlgnlmeglyskvvdikdgkvif neklalpvkpmigvigvapkegsincgtpgshggnmdttliaegaevyfpvfvegallal gdlhalmgdgevgvsgvevagkvllevevikglnlknpvvktaevtatiasaesldkave iavhdmaelfkkhtdlstegiatlfsitgnaqisqvvdplktarfslpnwilesygirf
Timeline for d3tkka1: