Lineage for d3tk7a_ (3tk7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098571Species Francisella tularensis [TaxId:119856] [196145] (6 PDB entries)
  8. 2098579Domain d3tk7a_: 3tk7 A: [216851]
    automated match to d3igxb_
    complexed with f6r

Details for d3tk7a_

PDB Entry: 3tk7 (more details), 2 Å

PDB Description: 2.0 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis in covalent complex with fructose 6- phosphate
PDB Compounds: (A:) Transaldolase

SCOPe Domain Sequences for d3tk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tk7a_ c.1.10.0 (A:) automated matches {Francisella tularensis [TaxId: 119856]}
qksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvk
annpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiar
yesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspf
vgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqviala
gcdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathklae
girlftkdtieleniikqnl

SCOPe Domain Coordinates for d3tk7a_:

Click to download the PDB-style file with coordinates for d3tk7a_.
(The format of our PDB-style files is described here.)

Timeline for d3tk7a_: