Lineage for d3tj3a_ (3tj3 A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (27 families) 
Family a.118.1.0: automated matches [191340] (1 protein)
not a true familyProtein automated matches [190220] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) 
Domain d3tj3a_: 3tj3 A: [216835]
automated match to d1ee5a_
Details for d3tj3a_
PDB Entry: 3tj3 (more details), 2.7 Å
PDB Description: Structure of importin a5 bound to the N-terminus of Nup50
PDB Compounds: (A:) Importin subunit alpha-1SCOPe Domain Sequences for d3tj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tj3a_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vitsdmiemifskspeqqlsatqkfrkllskepnppidevistpgvvarfveflkrkenc
tlqfesawvltniasgnslqtriviqagavpifiellssefedvqeqavwalgniagdst
mcrdyvldcnilppllqlfskqnrltmtrnavwalsnlcrgkspppefakvspclnvlsw
llfvsdtdvladacwalsylsdgpndkiqavidagvcrrlvellmhndykvvspalravg
nivtgddiqtqvilncsalqsllhllsspkesikkeacwtisnitagnraqiqtvidani
fpalisilqtaefrtrkeaawaitnatsggsaeqikylvelgcikplcdlltvmdskivq
valnglenilrlgeqeakrngtginpycalieeaygldkieflqshenqeiyqkafdlie
hyfgte
SCOPe Domain Coordinates for d3tj3a_:
Click to download the PDB-style file with coordinates for d3tj3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tj3a_:
- d3tj3a_ first appeared in SCOPe 2.03
- d3tj3a_ appears in SCOPe 2.06
- d3tj3a_ appears in the current release, SCOPe 2.08
View in 3D
