Lineage for d3suea_ (3sue A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795140Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1795230Protein automated matches [190658] (4 species)
    not a true protein
  7. 1795236Species Hepatitis C virus subtype 1a [TaxId:31646] [226463] (19 PDB entries)
  8. 1795255Domain d3suea_: 3sue A: [233636]
    automated match to d3sv8a_
    complexed with sue, zn

Details for d3suea_

PDB Entry: 3sue (more details), 2.2 Å

PDB Description: crystal structure of ns3/4a protease variant r155k in complex with mk- 5172
PDB Compounds: (A:) NS3 protease, NS4A protein

SCOPe Domain Sequences for d3suea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3suea_ b.47.1.3 (A:) automated matches {Hepatitis C virus subtype 1a [TaxId: 31646]}
gsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsin
gvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtr
hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavgifkaavstrgvakavdf
ipveslettm

SCOPe Domain Coordinates for d3suea_:

Click to download the PDB-style file with coordinates for d3suea_.
(The format of our PDB-style files is described here.)

Timeline for d3suea_: