Lineage for d3sk3a2 (3sk3 A:200-400)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.0: automated matches [227137] (1 protein)
not a true familyProtein automated matches [226839] (49 species)
not a true protein
Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries) 
Domain d3sk3a2: 3sk3 A:200-400 [216426]
automated match to d1g99a2
complexed with cit, edo
Details for d3sk3a2
PDB Entry: 3sk3 (more details), 1.9 Å
PDB Description: Crystal structure of Salmonella typhimurium acetate kinase (AckA) with citrate bound at the dimeric interface
PDB Compounds: (A:) acetate kinaseSCOPe Domain Sequences for d3sk3a2:
Sequence, based on SEQRES records: (download)
>d3sk3a2 c.55.1.0 (A:200-400) automated matches {Salmonella enterica [TaxId: 90371]}
pveelniitchlgnggsvsairngkcvdtsmgltpleglvmgtrsgdidpaiifhlhdtl
gmsvdqinkmltkesgllgltevtsdcryvednyatkedakramdvychrlakyigsyta
lmdgrldavvftggigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrp
avviptneelviaqdasrlta
Sequence, based on observed residues (ATOM records): (download)
>d3sk3a2 c.55.1.0 (A:200-400) automated matches {Salmonella enterica [TaxId: 90371]}
pveelniitchlgnggsvsairngkcvdtsmgltpleggdidpaiifhlhdtlgmsvdqi
nkmllgltevtsdcryvednyatkedakramdvychrlakyigsytalmdgrldavvftg
gigenaamvrelslgklgvlgfevdhernlaarfgksgfinkegtrpavviptneelvia
qdasrlta
SCOPe Domain Coordinates for d3sk3a2:
Click to download the PDB-style file with coordinates for d3sk3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3sk3a2:
- d3sk3a2 first appeared in SCOPe 2.03
- d3sk3a2 appears in SCOPe 2.04
- d3sk3a2 appears in SCOPe 2.06
- d3sk3a2 appears in the current release, SCOPe 2.08
View in 3D
