Lineage for d3sdwa_ (3sdw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922046Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries)
  8. 2922047Domain d3sdwa_: 3sdw A: [233530]
    automated match to d3qd5b_
    complexed with cl, edo, po4

Details for d3sdwa_

PDB Entry: 3sdw (more details), 1.8 Å

PDB Description: Crystal structure of a ribose-5-phosphate isomerase B RpiB from Coccidioides immitis bound to phosphate
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3sdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdwa_ c.121.1.0 (A:) automated matches {Coccidioides immitis [TaxId: 246410]}
lpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaqlik
dgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvigie
lakrlagewltyrfdqksasaqkvqaisdyekkfvevn

SCOPe Domain Coordinates for d3sdwa_:

Click to download the PDB-style file with coordinates for d3sdwa_.
(The format of our PDB-style files is described here.)

Timeline for d3sdwa_: