Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (11 species) not a true protein |
Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries) |
Domain d3sdwa_: 3sdw A: [233530] automated match to d3qd5b_ complexed with cl, edo, po4 |
PDB Entry: 3sdw (more details), 1.8 Å
SCOPe Domain Sequences for d3sdwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sdwa_ c.121.1.0 (A:) automated matches {Coccidioides immitis [TaxId: 246410]} lpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaqlik dgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvigie lakrlagewltyrfdqksasaqkvqaisdyekkfvevn
Timeline for d3sdwa_: