| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
| Protein automated matches [190475] (8 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226240] (2 PDB entries) |
| Domain d3s3ea_: 3s3e A: [216190] automated match to d2h04a_ complexed with 1bo, bu1, ipa |
PDB Entry: 3s3e (more details), 2.4 Å
SCOPe Domain Sequences for d3s3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3ea_ c.45.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmasrpiliknfaehyrlmsadsdfrfseefeelkhvgrdqpctfadlpcnrpknrftn
ilpydhsrfklqpvdddegsdyinanyvpghnsprefivtqgplhstrddfwrmcwesns
raivmltrcfekgrekcdqywpndtvpvfygdikvqilndshyadwvmtefmlcrgseqr
ilrhfhfttwpdfgvpnppqtlvrfvrafrdrigaeqrpivvhcsagvgrsgtfitldri
lqqintsdyvdifgivyamrkervwmvqteqqyicihqcllavlegk
Timeline for d3s3ea_: