Lineage for d3s3ea_ (3s3e A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) 
share with the family I the common active site structure with a circularly permuted topologyFamily c.45.1.0: automated matches [191381] (1 protein)
not a true familyProtein automated matches [190475] (8 species)
not a true protein
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226240] (2 PDB entries) 
Domain d3s3ea_: 3s3e A: [216190]
automated match to d2h04a_
complexed with 1bo, bu1, ipa
Details for d3s3ea_
PDB Entry: 3s3e (more details), 2.4 Å
PDB Description: Crystal structure of the catalytic domain of PTP10D from Drosophila melanogaster
PDB Compounds: (A:) Tyrosine-protein phosphatase 10DSCOPe Domain Sequences for d3s3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s3ea_ c.45.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shmasrpiliknfaehyrlmsadsdfrfseefeelkhvgrdqpctfadlpcnrpknrftn
ilpydhsrfklqpvdddegsdyinanyvpghnsprefivtqgplhstrddfwrmcwesns
raivmltrcfekgrekcdqywpndtvpvfygdikvqilndshyadwvmtefmlcrgseqr
ilrhfhfttwpdfgvpnppqtlvrfvrafrdrigaeqrpivvhcsagvgrsgtfitldri
lqqintsdyvdifgivyamrkervwmvqteqqyicihqcllavlegk
SCOPe Domain Coordinates for d3s3ea_:
Click to download the PDB-style file with coordinates for d3s3ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3s3ea_:
- d3s3ea_ first appeared in SCOPe 2.03
- d3s3ea_ appears in SCOPe 2.04
- d3s3ea_ is called d3s3ea1 in SCOPe 2.06
- d3s3ea_ appears in the current release, SCOPe 2.08, called d3s3ea1
View in 3D
