Lineage for d3rvba2 (3rvb A:326-630)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.14: RNA helicase [52724] (7 proteins)
duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
Protein HCV helicase domain, C-terminal domain [418963] (1 species) Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419425] (15 PDB entries) 
Domain d3rvba2: 3rvb A:326-630 [260021]
Other proteins in same PDB: d3rvba1
automated match to d1cu1a3
complexed with cl, i79, mg
has additional subdomain(s) that are not in the common domain
Details for d3rvba2
PDB Entry: 3rvb (more details), 2.2 Å
PDB Description: The structure of HCV NS3 helicase (Heli-80) bound with inhibitor ITMN-3479
PDB Compounds: (A:) RNA helicaseSCOPe Domain Sequences for d3rvba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rvba2 c.37.1.14 (A:326-630) HCV helicase domain, C-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pgsvtvphpnieevalsntgeipfygkaipievirggrhlifchskkkcdelaaklsalg
lnavayyrgldvsviptsgdvvvvatdalmtgytgdfdsvidcntcvtqtvdfsldptft
idtttvpqdavsrsqrrgrtgrgrrgiyrfvtpgerpsgmfdssvlcecydagcawyelt
paetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdnfpylvayqa
tvcaraqapppswdqmwksltrlkptlhgptpllyrlgalqnevtlthpvtkfimacmsa
dlevv
SCOPe Domain Coordinates for d3rvba2:
Click to download the PDB-style file with coordinates for d3rvba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rvba2:
- d3rvba2 first appeared in SCOPe 2.04
- d3rvba2 appears in SCOPe 2.07
View in 3D
