SCOPe 2.07: Domain d3rtqd1: 3rtq D:2-112

Lineage for d3rtqd1 (3rtq D:2-112)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
Domain d3rtqd1: 3rtq D:2-112 [200520]
Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc1, d3rtqc2, d3rtqd2
automated match to d1lp9f1
complexed with h4s, nag

Details for d3rtqd1

PDB Entry: 3rtq (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-hs44-inkt tcr complex

PDB Compounds: (D:) V beta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rtqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rtqd1 b.1.1.1 (D:2-112) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d3rtqd1:

Click to download the PDB-style file with coordinates for d3rtqd1.
(The format of our PDB-style files is described here.)

Timeline for d3rtqd1: