Lineage for d3rnja_ (3rnj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783781Protein automated matches [190043] (6 species)
    not a true protein
  7. 1783805Species Human (Homo sapiens) [TaxId:9606] [187799] (23 PDB entries)
  8. 1783811Domain d3rnja_: 3rnj A: [185062]
    automated match to d1spka_
    complexed with edo, edt, ipa

Details for d3rnja_

PDB Entry: 3rnj (more details), 1.5 Å

PDB Description: crystal structure of the sh3 domain from irsp53 (baiap2)
PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2

SCOPe Domain Sequences for d3rnja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnja_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsgrmrvkaifshaagdnstllsfkegdlitllvpeardgwhygesektkmrgwfpf
sytrvld

SCOPe Domain Coordinates for d3rnja_:

Click to download the PDB-style file with coordinates for d3rnja_.
(The format of our PDB-style files is described here.)

Timeline for d3rnja_: