Lineage for d3rnja1 (3rnj A:375-436)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783282Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)
  8. 2783306Domain d3rnja1: 3rnj A:375-436 [185062]
    Other proteins in same PDB: d3rnja2
    automated match to d1spka_
    complexed with edo, edt, ipa

Details for d3rnja1

PDB Entry: 3rnj (more details), 1.5 Å

PDB Description: crystal structure of the sh3 domain from irsp53 (baiap2)
PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2

SCOPe Domain Sequences for d3rnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnja1 b.34.2.1 (A:375-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grmrvkaifshaagdnstllsfkegdlitllvpeardgwhygesektkmrgwfpfsytrv
ld

SCOPe Domain Coordinates for d3rnja1:

Click to download the PDB-style file with coordinates for d3rnja1.
(The format of our PDB-style files is described here.)

Timeline for d3rnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rnja2