SCOPe 2.08: Domain d3rnja1: 3rnj A:375-436

Lineage for d3rnja1 (3rnj A:375-436)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d3rnja1: 3rnj A:375-436 [185062]
   Other proteins in same PDB: d3rnja2
   automated match to d1spka_
   complexed with edo, edt, ipa

Details for d3rnja1

PDB Entry: 3rnj, 1.5 Å

PDB Description: crystal structure of the sh3 domain from irsp53 (baiap2)

PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2

SCOPe Domain Sequences for d3rnja1:

Sequence; same for both SEQRES and ATOM records:

>d3rnja1 b.34.2.1 (A:375-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grmrvkaifshaagdnstllsfkegdlitllvpeardgwhygesektkmrgwfpfsytrv
ld

Timeline for d3rnja1:

• d3rnja1 first appeared in SCOPe 2.01, called d3rnja_
  
• d3rnja1 appears in SCOPe 2.07