| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
| Domain d3rnja1: 3rnj A:375-436 [185062] Other proteins in same PDB: d3rnja2 automated match to d1spka_ complexed with edo, edt, ipa |
PDB Entry: 3rnj (more details), 1.5 Å
SCOPe Domain Sequences for d3rnja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rnja1 b.34.2.1 (A:375-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grmrvkaifshaagdnstllsfkegdlitllvpeardgwhygesektkmrgwfpfsytrv
ld
Timeline for d3rnja1: