Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [189986] (2 PDB entries) |
Domain d3rihc_: 3rih C: [215836] automated match to d3s55a_ complexed with edo, k, pg5 |
PDB Entry: 3rih (more details), 2.15 Å
SCOPe Domain Sequences for d3rihc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rihc_ c.2.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]} vmfdlsarsvlvtggtkgigrgiatvfaraganvavaarsprelssvtaelgelgagnvi gvrldvsdpgscadaartvvdafgaldvvcanagifpearldtmtpeqlsevldvnvkgt vytvqaclapltasgrgrviltssitgpvtgypgwshygaskaaqlgfmrtaaielaprg vtvnailpgnilteglvdmgeeyisgmarsipmgmlgspvdighlaaflatdeagyitgq aivvdggqvlpespdavnp
Timeline for d3rihc_: