Lineage for d3rihc_ (3rih C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847657Species Mycobacterium abscessus [TaxId:561007] [189986] (2 PDB entries)
  8. 2847668Domain d3rihc_: 3rih C: [215836]
    automated match to d3s55a_
    complexed with edo, k, pg5

Details for d3rihc_

PDB Entry: 3rih (more details), 2.15 Å

PDB Description: crystal structure of a putative short chain dehydrogenase or reductase from mycobacterium abscessus
PDB Compounds: (C:) short chain dehydrogenase or reductase

SCOPe Domain Sequences for d3rihc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rihc_ c.2.1.0 (C:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
vmfdlsarsvlvtggtkgigrgiatvfaraganvavaarsprelssvtaelgelgagnvi
gvrldvsdpgscadaartvvdafgaldvvcanagifpearldtmtpeqlsevldvnvkgt
vytvqaclapltasgrgrviltssitgpvtgypgwshygaskaaqlgfmrtaaielaprg
vtvnailpgnilteglvdmgeeyisgmarsipmgmlgspvdighlaaflatdeagyitgq
aivvdggqvlpespdavnp

SCOPe Domain Coordinates for d3rihc_:

Click to download the PDB-style file with coordinates for d3rihc_.
(The format of our PDB-style files is described here.)

Timeline for d3rihc_: