Lineage for d3qyua_ (3qyu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806910Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 2806911Species Human (Homo sapiens) [TaxId:9606] [141512] (46 PDB entries)
    Uniprot P30405 44-207
  8. 2806942Domain d3qyua_: 3qyu A: [196214]
    automated match to d2z6wa_

Details for d3qyua_

PDB Entry: 3qyu (more details), 1.54 Å

PDB Description: crystal structure of human cyclophilin d at 1.54 a resolution at room temperature
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F

SCOPe Domain Sequences for d3qyua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyua_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d3qyua_:

Click to download the PDB-style file with coordinates for d3qyua_.
(The format of our PDB-style files is described here.)

Timeline for d3qyua_: