Lineage for d3qvad_ (3qva D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041793Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2042479Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2042480Protein automated matches [190651] (7 species)
    not a true protein
  7. 2042505Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry)
  8. 2042509Domain d3qvad_: 3qva D: [196216]
    Other proteins in same PDB: d3qvaa2, d3qvab2
    automated match to d2igla_
    complexed with po4

Details for d3qvad_

PDB Entry: 3qva (more details), 1.75 Å

PDB Description: structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase
PDB Compounds: (D:) transthyretin-like protein

SCOPe Domain Sequences for d3qvad_:

Sequence, based on SEQRES records: (download)

>d3qvad_ b.3.4.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
stlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltaet
gawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrgs

Sequence, based on observed residues (ATOM records): (download)

>d3qvad_ b.3.4.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
stlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltaet
gawfaragresvftraqidfvigdhfhlpfliapggwstyrgs

SCOPe Domain Coordinates for d3qvad_:

Click to download the PDB-style file with coordinates for d3qvad_.
(The format of our PDB-style files is described here.)

Timeline for d3qvad_: