Lineage for d3qkza_ (3qkz A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sitesSuperfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
Common fold covers whole protein structure
Protein automated matches [190169] (5 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [186935] (2 PDB entries) 
Domain d3qkza_: 3qkz A: [195953]
automated match to d3o3ra_
complexed with nap; mutant
Details for d3qkza_
PDB Entry: 3qkz (more details), 1.87 Å
PDB Description: Crystal structure of mutant His269Arg AKR1B14
PDB Compounds: (A:) Aldo-keto reductase family 1, member B7SCOPe Domain Sequences for d3qkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qkza_ c.1.7.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttfvklrtkakmplvglgtwksppgqvkeavkaaidagyrhfdcayvyqnesevgeaiqe
kikekavrredlfivsklwstffekslmkeafqktlsdlkldyldlylihwpqglqagke
flpkdsqgkvlmskstfldawegmeelvdqglvkalgvsnfnhfqierllnkpglkhkpv
tnqvechpyltqekliqychskgiaviaysplgspdrpyakpedpvvleipkikeiaakh
kktiaqvlirfhvqrnvavipksvtlsrikeniqvfdfqlseedmaailslnrnwracgl
fvtsdeedfpfheey
SCOPe Domain Coordinates for d3qkza_:
Click to download the PDB-style file with coordinates for d3qkza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qkza_:
- d3qkza_ first appeared in SCOPe 2.02
- d3qkza_ appears in SCOPe 2.05
- d3qkza_ appears in SCOPe 2.07
- d3qkza_ appears in the current release, SCOPe 2.08
View in 3D
